Fake Call, chat Avneet Kaur
Install Now
Fake Call, chat Avneet Kaur
Fake Call, chat Avneet Kaur

Fake Call, chat Avneet Kaur

this app for fan of Avneet Kaur and who love avneet and her wallpapers

Developer: KR Infotech
App Size: varies with devices
Release Date: Apr 26, 2022
Price: Free
Price
Free
Size
varies with devices

Screenshots for App

Mobile
Fake videocall, chat call with Avneet Kaur app to helps to fun and fake chat and video call with Avneet Kaur.
We added a lot of fake messages for users able to make a fake chat and fake video call with Avneet Kaur . Download it now!
this Avneet Kaur Fake Video Call App is A great way to prank your friends and family by making them think they're in a real call or chat with Avneet Kaur
Fake call allows you to more then one option like fake video call, fake audio call and fake chat with Avneet Kaur


Avneet Kaur is an Indian television actress.She started her career with Dance India Dance Li'l Masters as a contestant.
She then participated in Dance Ke Superstars. Kaur made her acting debut with Meri Maa, playing the character Jhilmil. Later, she was part of Tedhe Hain Par Tere Mere Hain.

Avneet Kaur is an Indian actress, dancer and model. She is known for portraying Charumati in Chandra Nandini and Princess Yasmine in Aladdin – Naam Toh Suna Hoga

latest and newest collection of Avneet Kaur wallpaper for all fan
Avneet Kaur 4k, Hd Wallpapers 2021 app is for the fan of Avneet Kaur,
If you love Avneet Kaur Wallpapers then is app is for you.
So stay with us on Avneet Kaur Wallpaper
This app contains a collection of the best free Avneet Kaur Wallpaper for your smartphone .
All our wallpapers have been personally selected so you can personalize your device .
Just one click and the most realistic and beautiful wallpapers will appear on screen of your mobile device.
Avneet Kaur App includes all kind of high-quality HD photos of Avneet Kaur.
It can be zoomed and see as you like. I will try to upload more photos in each update.


Feature of App:
--HD Quality of Avneet Kaur HD Wallpaper.
--Set As Wallpaper.
--Wonderful, Unique, Awesome Art and Avneet Kaur HD Wallpaper.
--You can save wallpaper & see saved list of your favorite.
--You can also share your Best wallpaper with social medias.
--Support all Brands Mobiles and Tablets.
--Call a video from Avneet Kaur
--Chat online with Avneet Kaur
--Opportunity to do a private live with Avneet Kaur
--Select the cellphone that is approaching the call screen
--Plan instant fake calls whenever you need
--Multiple categories and Ability to have a video call.
--Ability to send fake text messages to a Avneet Kaur
--spoof call

About permissions:- if we are asking about any permissions inside app, it just for access the apps feaures.

Disclaimer -
All logos/images/names are copyright of their perspective owners.
This app is purely fictional and is not an official app.
This App is not official, endorsed, sponsored, or specifically approved by any company just made for fun and just entertainment for fans Avneet Kaur.
Materials included in the application do not reflect the app creators’ thoughts and ideas.
this app is mainly for entertainment and for all fans to enjoy these Avneet Kaur Video Calls
if you have and question and If we have violated any copyright
by using any image included in this app please contact us at bellow mail
All Images\videos Used In This App Are Believed To Be In Public Domain. If You Own Rights To Any Of The Images, And Do Not
Wish Them To Appear Here, Please Contact Us And They Will Be
Removed.

If you like this app, rate us and perhaps write us a few lines. Your feedback will be much appreciated.

Privacy Policy
https://kdappsprivacy.wordpress.com/kr-infotech-2/
Show More
Show Less
More Information about: Fake Call, chat Avneet Kaur
Price: Free
Version: 1.0
Downloads: 100
Compatibility: Android 4.4
Bundle Id: com.avneetkaurfakecallandwallpaper.avneetkaurfakecallandwallpaper
Size: varies with devices
Last Update: Apr 26, 2022
Content Rating: Everyone
Release Date: Apr 26, 2022
Content Rating: Everyone
Developer: KR Infotech


Whatsapp
Vkontakte
Telegram
Reddit
Pinterest
Linkedin
Hide