Radhe Krishna Shayari HD Wallpaper
Install Now
Radhe Krishna Shayari HD Wallpaper
Radhe Krishna Shayari HD Wallpaper

Radhe Krishna Shayari HD Wallpaper

Religious Wallpaper, Krishna Bhakti, Radha-Krishan Love, Kanha Love Shayari

Developer: Chalisa Sangrah
App Size: 10M
Release Date: Nov 7, 2019
Price: Free
3.9
11 Ratings
Size
10M

Screenshots for App

Mobile
Radhe Krishna Shayari HD Wallpaper || राधे कृष्णा -हिंदी शायरी
राधा-कृष्ण के प्रेम को पूरी दुनिया जानती हैं राधा-कृष्ण की प्रेम कहानी अपने आप में प्रेम की परिभाषा हैं हमने इस एप्प में राधा कृष्णा के प्रेम को दिखाया है। राधे कृष्णा हिंदी शायरी में आपको मिलेंगी राधा कृष्ण की फोटोज पर सूंदर शायरी। आप इन शायरी को आसानी शेयर भी कर सकतें हैं।

- Silent Features of Radhe Krishna Shayari HD Wallpaper app.
☀️ Share: Share your status with your friends and family members via Whatssup, Email, SMS and other available sharing options on your device.
☀️ Professionally designed, user-friendly and intuitive interface.
☀️ Simple app. No internet connection needed!


◙Disclaimer:
1. This app is a self-contained offline app with a part of the contents from public domain.
2. The purpose of app is to provide entertainment/general information to user. All the images and text contained in the app are collected from different internet sources. All the images are readily available in various places on the internet and are believed to be in the public domain. However, we do not claim ownership/copyright of material/media used in the app. We acknowledge that the respective copyright owners of the contents own the rights. If you own the right to any content in the app, please write to us at [email protected] with the copyright details of the original source. No infringement intended.
Show More
Show Less
More Information about: Radhe Krishna Shayari HD Wallpaper
Price: Free
Version: CA 1.0.1
Downloads: 5000
Compatibility: Android 4.0.3 and up
Bundle Id: com.chalisaapps.radhekrishanwallpapershayari
Size: 10M
Last Update: Nov 7, 2019
Content Rating: Everyone
Release Date: Nov 7, 2019
Content Rating: Everyone
Developer: Chalisa Sangrah


Whatsapp
Vkontakte
Telegram
Reddit
Pinterest
Linkedin
Hide