Lakshmi Mata Wallpaper
Install Now
Lakshmi Mata Wallpaper
Lakshmi Mata Wallpaper

Lakshmi Mata Wallpaper

Lakshmi Mata Wallpaper app to start day with blessings of Goddess Lakshmi.

Developer: DigitalWizerd
App Size: 16M
Release Date: Nov 6, 2021
Price: Free
Price
Free
Size
16M

Set Lakshmi Mata Wallpaper from this app to start your day with blessings of Goddess Lakshmi.

This Application contains a quality collection of best Lakshmi Mata wallpapers, backgrounds with high quality of Lakshmi Mata wallpapers to set as a home screen and lock screen of your smart phone or Tablet. All our Lakshmi Mata wallpapers has been personally selected for personalize your device.

Lakshmi ma is a wife of Vishnu also known as a named Mahalakshmi. She is the Hindu Goddess of wealth, love, prosperity (both material and spiritual), fortune, and the embodiment of beauty. According to Puranas s Lakshmi Devi and Saraswathi along with Durga Maa are known as the Trivedi.

Enjoy the lovely Wallpaper of Lakshmi Mata in HD Quality pictures. the divine a symbol of love and purity. This Lakshmi Mata Wallpapers app has beautiful images with colourful flowers and twinkling stars. You will be happy to see such a nice collection of Lord Lakshmi Mata Wallpapers in one single wallpaper application.

Features
• High-Quality Wallpapers
• Save wallpaper
• Share wallpaper picture to social media networks
• Set as wallpaper
• Easy interface to use

Rate it if you liked the App ?
Probably a valuable 5 Star Rating ??

Your Feedback is as important as you so we can provide more content to you. ?

DISCLAIMER:
All images used in this app are believed to be in public domain. If you own rights to any of the images, and do not wish them to appear here, please contact us and they will be removed in the next version of the application.
Show More
Show Less
More Information about: Lakshmi Mata Wallpaper
Price: Free
Version: 1.0
Downloads: 1
Compatibility: Android 5.0 and up
Bundle Id: com.microtechdiary.lakshmimatawallpaper
Size: 16M
Last Update: Nov 6, 2021
Content Rating: Everyone
Release Date: Nov 6, 2021
Content Rating: Everyone
Developer: DigitalWizerd


Whatsapp
Vkontakte
Telegram
Reddit
Pinterest
Linkedin
Hide